General Information

  • ID:  hor003028
  • Uniprot ID:  P48645
  • Protein name:  Neuromedin-U-25
  • Gene name:  NMU
  • Organism:  Homo sapiens (Human)
  • Family:  NmU family
  • Source:  Human
  • Expression:  Expressed throughout the enteric nervous system with highest levels being found in the jejunum.
  • Disease:  Diseases associated with NMU include Squamous Cell Papilloma and Body Mass Index Quantitative Trait Locus 11.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005515 protein binding; GO:0031839 type 1 neuromedin U receptor binding; GO:0031840 type 2 neuromedin U receptor binding; GO:0042922 neuromedin U receptor binding
  • GO BP:  GO:0001659 temperature homeostasis; GO:0006940 regulation of smooth muscle contraction; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0045987 positive regulation of smooth muscle contraction; GO:0050806 positive regulation of synaptic transmission; GO:0060259 regulation of feeding behavior; GO:0097009 energy homeostasis; GO:2000821 regulation of grooming behavior
  • GO CC:  GO:0005576 extracellular region; GO:0043195 terminal bouton

Sequence Information

  • Sequence:  FRVDEEFQSPFASQSRGYFLFRPRN
  • Length:  25(142-166)
  • Propeptide:  MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
  • Signal peptide:  MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAG
  • Modification:  T25 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NMUR1, NMUR2
  • Target Unid:   Q9HB89, Q9GZQ4
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q29PV4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q29PV4-F1.pdbhor003028_AF2.pdbhor003028_ESM.pdb

Physical Information

Mass: 350962 Formula: C141H202N40O39
Absent amino acids: CHIKMTW Common amino acids: F
pI: 9.35 Basic residues: 4
Polar residues: 6 Hydrophobic residues: 8
Hydrophobicity: -90 Boman Index: -8347
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 31.2
Instability Index: 9530 Extinction Coefficient cystines: 1490
Absorbance 280nm: 62.08

Literature

  • PubMed ID:  NA
  • Title:  NA